General Information

  • ID:  hor005175
  • Uniprot ID:  P63152
  • Protein name:  Gastrin-releasing peptide
  • Gene name:  GRP
  • Organism:  Cavia porcellus (Guinea pig)
  • Family:  Bombesin/neuromedin-B/ranatensin family
  • Source:  animal
  • Expression:  small intestine
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cavia (genus), Caviidae (family), Hystricomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0043303 mast cell degranulation; GO:0090277 positive regulation of peptide hormone secretion; GO:1900738 positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway; GO:1903817 negative regulation of voltage-gated potassium channel activity; GO:1903942 positive regulation of respiratory gaseous exchange; GO:1905151 negative regulation of voltage-gated sodium channel activity; GO:2000987 positive regulation of behavioral fear response
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0031410 cytoplasmic vesicle; GO:0034774 secretory granule lumen; GO:0042995 cell projection; GO:0043005 neuron projection

Sequence Information

  • Sequence:  APVSVGGGTVLAKMYPRGNHWAVGHLM
  • Length:  27
  • Propeptide:  MRGPELRLVLLALVLCQAPLGPAAPVSVGGGTVLAKMYPRGNHWAVGHLMGKKSTGESRHVLEGDGLKELLRDDIQWEEATRNLLGLIEAKGNSSHRSPQLKPLSTHQPTLDTEDSSNLKDVQLAKLVDYLLQGLKAKEGALS
  • Signal peptide:  MRGPELRLVLLALVLCQAPLGPA
  • Modification:  T27 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the release of gastrin and other gastrointestinal hormones (By similarity). Contributes to the perception of prurient stimuli and to the transmission of itch signals in the spinal cord that promote scratching behavior. Contributes primarily to nonhistaminergic itch sensation. Contributes to long-term fear memory, but not normal spatial memory. Contributes to the regulation of food intake (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  GRPR
  • Target Unid:  H0UU11
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P63152-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005175_AF2.pdbhor005175_ESM.pdb

Physical Information

Mass: 327025 Formula: C126H197N37O32S2
Absent amino acids: CDEFIQ Common amino acids: G
pI: 10.45 Basic residues: 4
Polar residues: 9 Hydrophobic residues: 10
Hydrophobicity: 23.7 Boman Index: 62
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 82.96
Instability Index: 3330.37 Extinction Coefficient cystines: 6990
Absorbance 280nm: 268.85

Literature

  • PubMed ID:  3668528
  • Title:  Primary structure and tissue distribution of guinea pig gastrin-releasing peptide.